ear plug for noise reduction

Safety Silicone Reusable Ear Plugs for personal hearing proctection Description of Reusable Ear plugs : Material The ear plugs are made of silicone, w...

... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The is capable to cancel up to 33 dB of noi...

Description The Noise Ear Plugs realize the function to reduce work, home, sleep and safety noise. Due to the washable and reusable design, it is real...

... Protector Reusable Hearing Protection Earplugs Earmuff Features: Reduce the can be reduced NRR: 24dB; SNR: 25d...

Wired In phones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo 2. In type, ...

Wired In phones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo 2. In type, ...

... Function Reduce Harmful Type In- Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

... phones Wired phone Information Item Number 3404-FY148 Communication Wired phone Color Multi color 3.5mm straight Cable Flat ...

... Headphones with Volume Control LED Light Cool Style Stereo phone features: Compatibility: With 3. 5mm audio cable jack (USB ...

... deep bass sound function can be enabled in a variety of states, including Bluetooth on or off, -in state Soft protein memory f...

...3.5 audio cable to connect the headset to enjoy high quality music playback, good function, functional. Bluetooth headset with...