foam for noise reduction

EPDM E-4088 Black rubber automotive and shock-proof Material / Feature / Application : E-4088 sponge rubber has low hardness...

3 - 12mm Thickness Fire Retardant Insulation Acoustic Irradiated cross-linked polyethylene (IXPE ) is very fine celled m...

... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is ...

...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...

... of metal aluminum with 2400*800mm*50mm for soundproofing material Products Description of metal aluminum: The large demension :2400*800m...

33kg/m3 IXPE Foam Underlay 200sqft/roll Noise Reduction Underlayment Black 3mm IXPE Normal Underlayment , Noise Reduction Underlayment Features Design...

Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...

... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...

... canceling earmuffs passive reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in th...

...barrier, or acoustical barrier) is an Sound insulation and reductionexterior structure designed to protect inhabitants of sensitive land use ...

... of ear canal, ensuring a better sealing, maximum and optimal hearing protection. Performance Earplug dispenser with earplugs, the ...

... of roads, highways, elevated composite roads and other sources. It is divided into a purely sound-reflecting reflective sound barr...

... Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep ...

... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active Features Immersive sound Premium speaker drivers deli...