EPDM E-4088 Black rubber automotive and shock-proof Material / Feature / Application : E-4088 sponge rubber has low hardness...
Add to Cart
3 - 12mm Thickness Fire Retardant Insulation Acoustic Irradiated cross-linked polyethylene (IXPE ) is very fine celled m...
Add to Cart
... is designed for using under floated laminate, bamboo and engineered wood floors and is ideal for many types of sub-flooring. This underlayment is ...
Add to Cart
...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...
Add to Cart
... of metal aluminum with 2400*800mm*50mm for soundproofing material Products Description of metal aluminum: The large demension :2400*800m...
Add to Cart
33kg/m3 IXPE Foam Underlay 200sqft/roll Noise Reduction Underlayment Black 3mm IXPE Normal Underlayment , Noise Reduction Underlayment Features Design...
Add to Cart
Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...
Add to Cart
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...
Add to Cart
...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...
Add to Cart
... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...
Add to Cart
... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...
Add to Cart
... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...
Add to Cart
... canceling earmuffs passive reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in th...
Add to Cart
...barrier, or acoustical barrier) is an Sound insulation and reductionexterior structure designed to protect inhabitants of sensitive land use ...
Add to Cart
... of ear canal, ensuring a better sealing, maximum and optimal hearing protection. Performance Earplug dispenser with earplugs, the ...
Add to Cart
... of roads, highways, elevated composite roads and other sources. It is divided into a purely sound-reflecting reflective sound barr...
Add to Cart
... Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep ...
Add to Cart
... Article No.: B09 Split earbuds Wireless earbuds with immersive sound, active Features Immersive sound Premium speaker drivers deli...
Add to Cart