noise reduction foam

Recommend Insulation Boards Heat Resistant Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity...

...dustproof sealing, shock absorption resistance and . Suitable for electronic products, automotive parts, precision industrial equipm...

... Underlay 200sqft/roll Underlayment The Green IXPE flooring underlayment is 2mm thick and will provide you with the best p...

3 - 12mm Thickness Fire Retardant Insulation Acoustic Irradiated cross-linked polyethylene (IXPE ) is very fine celled m...

...IXPE For Wood Floor Comfort Step And Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and...

... Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU (Latex free and ...

... of metal aluminum with 2400*800mm*50mm for soundproofing material Products Description of metal aluminum: The large demension :2400*800m...

33kg/m3 IXPE Foam Underlay 200sqft/roll Noise Reduction Underlayment Black 3mm IXPE Normal Underlayment , Noise Reduction Underlayment Features Design...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory for comfortable we...

... knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with...

... Function Reduce Harmful Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying ...

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose ...

... Rubber Weather Stripping Epdm Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile ...

... canceling earmuffs passive reduction design 33dB Product Advantage: 1. New technology with double casing that minimizes resonance in th...

...barrier, or acoustical barrier) is an Sound insulation and reductionexterior structure designed to protect inhabitants of sensitive land use ...

... of ear canal, ensuring a better sealing, maximum and optimal hearing protection. Performance Earplug dispenser with earplugs, the ...

... of roads, highways, elevated composite roads and other sources. It is divided into a purely sound-reflecting reflective sound barr...

... Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep ...